PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00408.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 263aa    MW: 30413.7 Da    PI: 7.9385
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00408.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.44.3e-202471148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd+ll+d+v+  G g+W+++a++ g++R++k+c++rw +yl
  Rsa1.0_00408.1_g00004.1 24 KGPWTPEEDKLLADYVTSNGEGRWSSVAKCAGLNRSGKSCRLRWVNYL 71
                             79********************************************97 PP

2Myb_DNA-binding50.16.6e-1677121147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg  T++E+ ++++++ ++G++ W+tIar+++ gRt++++k++w+++
  Rsa1.0_00408.1_g00004.1  77 RGQITPQEEGIILELHSLWGNK-WSTIARYLP-GRTDNEIKNYWRTH 121
                              7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.2321971IPR017930Myb domain
SuperFamilySSF466892.32E-3121118IPR009057Homeodomain-like
SMARTSM007171.1E-152373IPR001005SANT/Myb domain
PfamPF002493.3E-182471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-242578IPR009057Homeodomain-like
CDDcd001671.96E-112671No hitNo description
PROSITE profilePS5129424.15972126IPR017930Myb domain
SMARTSM007171.8E-1376124IPR001005SANT/Myb domain
PfamPF002499.4E-1477121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2379125IPR009057Homeodomain-like
CDDcd001671.74E-981121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MLDWGVDQVH HQNHDLYQQQ GCRKGPWTPE EDKLLADYVT SNGEGRWSSV AKCAGLNRSG  60
KSCRLRWVNY LRPGLKRGQI TPQEEGIILE LHSLWGNKWS TIARYLPGRT DNEIKNYWRT  120
HYKKKERSFS KQEKVKRSRK QLDLKPQPQQ QTQSSQLVSK DHMNLDNEQN TFSYQTGVFS  180
DQFLMPQVVA ATSSDHTMMD ERNLWDSLWS LDDHDPHHFG GGSEQRTATN IAEKFNGCGI  240
NAPFCGSWDY SYDGFNTGGY NYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24241257107B-MYB
1h8a_C2e-242412527127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719801e-131AF371980.2 Arabidopsis thaliana putative transcription factor MYB121 (MYB121) mRNA, complete cds.
GenBankAY5195931e-131AY519593.1 Arabidopsis thaliana MYB transcription factor (At3g30210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596850.11e-174PREDICTED: myb-related protein 305
RefseqXP_013705798.11e-174PREDICTED: myb-related protein 305-like
TrEMBLA0A078D7Y81e-174A0A078D7Y8_BRANA; BnaC07g25960D protein
TrEMBLA0A0D3DBL11e-174A0A0D3DBL1_BRAOL; Uncharacterized protein
STRINGBra025410.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-118myb domain protein 121